General Information

  • ID:  hor004583
  • Uniprot ID:  P0CG35
  • Protein name:  Thymosin beta-15B
  • Gene name:  TMSB15B
  • Organism:  Homo sapiens (Human)
  • Family:  Thymosin beta family
  • Source:  Human
  • Expression:  Expressed in colon and colon cancer tissue.
  • Disease:  Diseases associated with TMSB15B include Pelizaeus-Merzbacher Disease.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0030335 positive regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005575 cellular_component; GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
  • Length:  44
  • Propeptide:  MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton. May be involved in cell migration.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0CG35-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004583_AF2.pdbhor004583_ESM.pdb

Physical Information

Mass: 586477 Formula: C215H360N60O80S
Absent amino acids: AGHMWY Common amino acids: K
pI: 5.02 Basic residues: 9
Polar residues: 13 Hydrophobic residues: 7
Hydrophobicity: -157.5 Boman Index: -16088
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.64
Instability Index: 4630.45 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12665801
  • Title:  Exploring Proteomes and Analyzing Protein Processing by Mass Spectrometric Identification of Sorted N-terminal Peptides